r/controld subreddit icon
Active

r/controld

Managed DNS with superpowers. Block unwanted content, bypass censorship and be more productive. THIS IS NOT A GEO-UNBLOCKING SERVICE. If…

Subscribers

7,094

Created

February 26, 2020

6 years ago

View on Reddit
RedPulse insight

How to think about r/controld

The community focuses on ControlD, a managed DNS service that enhances internet browsing by blocking unwanted content and improving productivity. Members discuss features like redirection, telemetry, and domain whitelisting, emphasizing the service's ability to bypass censorship without being a geo-unblocking tool. The community is distinct for its technical discussions and user-driven support for optimizing DNS configurations.

Confidence 4/5

  • Audience

    Participants are typically tech-savvy individuals, including IT professionals, developers, and privacy-conscious users who seek to enhance their online experience. They are interested in topics related to internet security, content management, and DNS technologies. The vibe is collaborative and solution-oriented, with members eager to share insights and troubleshoot issues together.

  • Posting culture

    Content that thrives includes detailed questions about DNS configurations, troubleshooting tips, and discussions about new features or updates. Members appreciate well-researched posts and clear explanations, while vague or promotional content is often downvoted. The community encourages regular engagement, with active discussions occurring frequently, particularly around updates or common issues.

  • Brand engagement notes

    Brands should approach this community with caution, as members are generally resistant to overt promotion. Authentic engagement through sharing valuable insights, answering technical questions, or providing useful resources can foster goodwill. Brands might consider sponsoring informative posts or collaborating on educational content that aligns with the community's interests, rather than direct advertising, to build trust and credibility.

Top keywords

What r/controld talks about

Weighted by how often each term appears in posts and comments, relative to baseline frequency. The largest words are the strongest signals of community focus.

redirectionipv6telemetryredirectingipv4dnswhitelistbufferingunblockredirectedttlbypassingdomainsspoofredirectwhitelistedfubotvredirectsbypassedconfiguredurlsresolverwhitelistingunblockedbypasspfsenseproxiesscopesconfiguringroutertlsencryptedblacklistedgrayedairplaydistrosconfiguratorbad:ip'simpressestrackerscircumvent40$configuremalwareproxyselectsphishingmessage:unboundcosmopolitanvlansrelevancysimplifiestryedchromecastinvestslocalizationhonkingbtw:

External signals

Where the community looks

Top external domains linked from posts and comments — a quick read on the sources of truth this audience trusts.

Top contributors

Who shapes the conversation

The most active and most-upvoted posters and commenters in this community. Useful when planning outreach or studying a community's tastemakers.

Top posters

By post count

By votes

Top commenters

By comment count

By votes

Similar communities

Where this audience also spends time

Topic-adjacent communities surfaced from Reddit's own related subreddit signal.

FAQ

r/controld — frequently asked questions

Quick facts about this subreddit's size, history, focus, and related communities.

How many subscribers does r/controld have?

r/controld has approximately 7,094 subscribers as of July 11, 2026.

When was r/controld created?

r/controld was created on February 26, 2020 (6 years ago).

What is r/controld about?

The community focuses on ControlD, a managed DNS service that enhances internet browsing by blocking unwanted content and improving productivity. Members discuss features like redirection, telemetry, and domain whitelisting, emphasizing the service's ability to bypass censorship without being a geo-unblocking tool. The community is distinct for its technical discussions and …

What subreddits are similar to r/controld?

Communities similar to r/controld include r/nextdns, r/windscribe, r/adguard, r/dnscrypt, r/dns.

Who are the most active posters on r/controld?

The most frequent posters on r/controld include u/HarryMuscle, u/sasagr, u/williabe.

Ready to engage on r/controld?

Authentic engagement, not spam.

RedPulse runs Reddit campaigns the way the platform actually rewards — high-karma accounts, native conversations, and content moderators welcome.